SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024021 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024021
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-26
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 2 Region: 84-180
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-23
Family Second domain of FERM 0.0011
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-20
Family First domain of FERM 0.0018
Further Details:      
 
Domain Number 4 Region: 381-430
Classification Level Classification E-value
Superfamily RING/U-box 0.00000565
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024021   Gene: ENSRNOG00000017579   Transcript: ENSRNOT00000024021
Sequence length 445
Comment pep:known chromosome:Rnor_5.0:17:21703597:21725205:-1 gene:ENSRNOG00000017579 transcript:ENSRNOT00000024021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKESLLAGHLQCSPEQAVELS
ALLAQTKFGDYNQNTAQYSYEDLCEKELSSSTLNSIVGKHKELEGISQASAEYQVLQIVS
AMENYGIEWHAVRDSEGQKLLIGVGPEGISICKEDFSPINRIAYPVVQMATQSGKNVYLT
VTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRNDQSPPSSPLKSSDSSMSC
SSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPV
CRSRVEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences D3ZDI6
ENSRNOP00000024021 10116.ENSRNOP00000024021 NP_001100814.2.100692 NP_001100814.2.4139 ENSRNOP00000024021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]