SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024191 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024191
Domain Number 1 Region: 53-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000183
Family Spermadhesin, CUB domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000024191
Domain Number - Region: 181-288
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0143
Family Spermadhesin, CUB domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024191   Gene: ENSRNOG00000017890   Transcript: ENSRNOT00000024191
Sequence length 322
Comment pep:known chromosome:Rnor_5.0:2:44299507:44311225:-1 gene:ENSRNOG00000017890 transcript:ENSRNOT00000024191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPNFKLQCHFTLILLTALRGESRYLEVQEAAVYDPFLLFSANLKRNLAEEQPYRRALRC
LDMLSLPGQFTFTADQPQLHCAAFFIGEPEEFITIHFDLVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPTRERYTDFCESGLTRRSVTSSQNVAMVFFRVHEPGNGFTITIKTDPNL
FPCNIISQTPSGRFTLVVPYQHQNCSFSIIYPVTIKISDLALGHLHGLQLKKPAAGCGGT
GDFVELLGGTGLDTSKMMLLVDLCYPFHGPAQMKISCDNAVVRMVSSGKHMNRVTFEYRQ
LEPLELETSTRNSIPEYCLSSL
Download sequence
Identical sequences O35761
NP_631922.1.100692 NP_631922.1.4139 10116.ENSRNOP00000024191 ENSRNOP00000024191 ENSRNOP00000024191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]