SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024199 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024199
Domain Number 1 Region: 54-221
Classification Level Classification E-value
Superfamily PR-1-like 1.06e-51
Family PR-1-like 0.00012
Further Details:      
 
Domain Number 2 Region: 289-387
Classification Level Classification E-value
Superfamily LCCL domain 1.24e-29
Family LCCL domain 0.0011
Further Details:      
 
Domain Number 3 Region: 391-495
Classification Level Classification E-value
Superfamily LCCL domain 4.05e-28
Family LCCL domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024199   Gene: ENSRNOG00000017773   Transcript: ENSRNOT00000024199
Sequence length 500
Comment pep:known chromosome:Rnor_5.0:5:665941:706220:-1 gene:ENSRNOG00000017773 transcript:ENSRNOT00000024199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCKAQEWLRMTALLFVARAVPAMVVPNATLLEKLLEKYMDEDDEWWTAKQRGKRAITDN
DMQSILDLHNKLRSQVYPAASNMEYMTWDVELERSAESWAETCLWEHGPTSLLPSIGQNL
GAHWGRYRPPTFHVQAWYDEVRDFSYPYEHECDPYCPFRCSGPVCTHYTQVVWATSSRIG
CAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGKPCSACPPSFGGGCRENLC
YKEGSDQYYTPQEEETNEIERQESQVHDTHVRTRSDDSNRNDVISTQQMSQIVSCEVRLR
DQCKGTTCNRYECPAGCLDSKAKVIGSVHYEMQSSICRAAIHYGIIDNEGGWVDVTRQGR
KHYFIKSNRNGIQTIGKYRSANSFIVSKVTVQAVTCETTVEQLCPFHKPASHCPRVYCPR
NCMQANPHYARVIGSRIYSDLSSICRAAVHAGVIRNHGGYVDVMPVDKRRMYTASFQNGI
FSESLQNPTGGKAFRVFAVV
Download sequence
Identical sequences B5DFM5
ENSRNOP00000024199 ENSRNOP00000024199 10116.ENSRNOP00000024199 NP_001128435.1.100692 NP_001128435.1.4139 XP_008761699.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]