SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024301 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024301
Domain Number 1 Region: 21-163
Classification Level Classification E-value
Superfamily GINS helical bundle-like 1.52e-50
Family SLD5 N-terminal domain-like 0.000000299
Further Details:      
 
Domain Number 2 Region: 166-223
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.00000000000000314
Family SLD5 C-terminal domain-like 0.0000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024301   Gene: ENSRNOG00000018040   Transcript: ENSRNOT00000024301
Sequence length 223
Comment pep:known chromosome:Rnor_5.0:16:73218779:73230596:1 gene:ENSRNOG00000018040 transcript:ENSRNOT00000024301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEVLDLHGQDSDEGSEEVVLTPAELIERLEQAWMNEKFAPELLESKSEIVECVVEQLEH
MEENLRRAKKGDLKVSIHRMEMERIRYVLSSYLRCRLMKIEKFFPHILEKEKTRPAGEPS
SLSPEEFVFAKEYMDHTETHFKNVALKHMPPNLQKVDLMRAVPKPDLDSYVFLRVKERQE
NILVEPEADEQRDYVIDLEEGSQHLIRYKTIAPLVASGAVQLI
Download sequence
Identical sequences G3V8B5
ENSRNOP00000024301 10116.ENSRNOP00000024301 ENSRNOP00000024301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]