SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024423 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024423
Domain Number 1 Region: 3-224
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.004
Further Details:      
 
Domain Number 2 Region: 313-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000647
Family FAD/NAD-linked reductases, N-terminal and central domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024423   Gene: ENSRNOG00000018076   Transcript: ENSRNOT00000024423
Sequence length 533
Comment pep:known chromosome:Rnor_5.0:2:219274827:219301535:1 gene:ENSRNOG00000018076 transcript:ENSRNOT00000024423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKRIAVIGSGASGLTCIKCCLEEGLEPVCFEMSDDIGGLWRYQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNSQVLEYFRMYAKEFGLLKYIQFKTTVCSVKKQPDF
STSGQWQVVTEHEGKEQVDVFDGVLVCTGHHTDPHLPLDSFPGIEKFKGKYFHSREYKNP
VEFTGKRVIVIGIGNSGGDLAVEISHTAKQVFLSTRRGAWILNRVGKHGYPIDILLSSRI
TNYLSKICGSALKNRYMEKQLNQRFDHEMFGLKPKHSALGQHPTINDDLPNRIISGLVKV
KGNVKEFTETAAIFEDGSREDDIDVVIFATGYSFAFPFLEDSVKVVQNKVSLYKKVFPPN
LEKPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKKLPSQSEMMAEINKTREEMAKRY
VDSQRHTIQGDYIDTMEEIADLVGVRPNLLSLAFTDPKLAFQLLVGPCTPVQYRLQGPGK
WAGARKTILTTEDRIRKPLMTRVVERDSSGTSLVTVRVLMLAVTFLAVILAYF
Download sequence
Identical sequences A0A0G2JSQ2
ENSRNOP00000024423 10116.ENSRNOP00000024423 ENSRNOP00000024423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]