SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025051 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025051
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.72e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000391
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 3.01e-61
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000169
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.7e-39
Family AlaX-like 0.043
Further Details:      
 
Domain Number 4 Region: 515-593
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000215
Family AlaX-M N-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025051   Gene: ENSRNOG00000018404   Transcript: ENSRNOT00000025052
Sequence length 968
Comment pep:known chromosome:Rnor_5.0:19:54018027:54040573:-1 gene:ENSRNOG00000018404 transcript:ENSRNOT00000025052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTLTAREIRERFINYFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTVDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVERLYVTYFGGDEAAGLEPDLECRQIWQNLGLDEAKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRESDGVLKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDTDGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCQTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRAKGLEA
TDDSPKYNYHSDSSGSYVFECTVATVLALRREKMFVDEVVTGQECGVVLDKTCFYAEQGG
QIFDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGNLRVGDQVRLFIDEPRRRP
VMSNHTATHILNFALRSVLGDADQKGSLVAPDRLRFDFTAKGAMSTEQIKKTEEIVNGMI
EAAKPVYTLDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV
EFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKSETLKKSLSAMEVK
VKAQSAPNKDVQKEIADLGEVLATAVIPQWQKDEQRETLKSLKKVMDDLDRASKADVQKR
VLEKTKQLIDSNPNQPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDMSAQATGKNVGCLQEALQLATSFAQ
LRLGDVKN
Download sequence
Identical sequences P50475
ENSRNOP00000025051 NP_001093987.1.100692 NP_001093987.1.4139 XP_006255642.1.100692 XP_006255643.1.100692 XP_006255644.1.100692 XP_006255645.1.100692 10116.ENSRNOP00000025051 ENSRNOP00000025051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]