SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025070 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025070
Domain Number 1 Region: 318-681
Classification Level Classification E-value
Superfamily SIS domain 4.17e-104
Family double-SIS domain 0.000000393
Further Details:      
 
Domain Number 2 Region: 2-212,249-293
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.08e-52
Family Class II glutamine amidotransferases 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025070   Gene: ENSRNOG00000018507   Transcript: ENSRNOT00000025070
Sequence length 681
Comment pep:known chromosome:Rnor_5.0:4:183421403:183467041:1 gene:ENSRNOG00000018507 transcript:ENSRNOT00000025070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGLDGGNDKDWEANACKIQLI
KKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPSPVNSHPQRSDKNNEFIV
IHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNWESQDVSFTTLVERVIQQ
LEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTGKDKKGSCGLSR
VDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTARD
HPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHI
KEIQRCRRLILIACGTSYHAGMATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFI
SQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTS
QFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSV
LIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYA
KCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHL
AVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences P82808
NP_001005879.1.100692 NP_001005879.1.4139 ENSRNOP00000025070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]