SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025252 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025252
Domain Number 1 Region: 36-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025252   Gene: ENSRNOG00000018706   Transcript: ENSRNOT00000025252
Sequence length 265
Comment pep:novel chromosome:Rnor_5.0:17:72156606:72185115:-1 gene:ENSRNOG00000018706 transcript:ENSRNOT00000025252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPQLRGCGVHALPMLLPLLLLLLLLLPLRVTPGITCPTPISIEHADIRVKNYSVNSRE
RYVCNSGFKRKAGTSTLTECVINKNTNVAHWTTPNLKCIRDPSLAHYSPVPTVVTPKVTS
QPESLSPPEKEPEALSPKSDTTVATETAIVPGSRLTPSQAASAGTTGTGRHKSSPAPSLA
TTMTLEPTASTSLRITEISPHSSEMTKVAIPTSVLLVAAGIGLVFLTRYIKSRQASQPRR
VEVETMETVPMTVRARSKEDEDHTT
Download sequence
Identical sequences ENSRNOP00000025252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]