SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025289 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025289
Domain Number 1 Region: 54-229
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 6.28e-59
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025289   Gene: ENSRNOG00000018711   Transcript: ENSRNOT00000025293
Sequence length 242
Comment pep:known chromosome:Rnor_5.0:8:60649506:60673125:-1 gene:ENSRNOG00000018711 transcript:ENSRNOT00000025293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPAQDHTPDQENSPGQDLDSCFTGQILLSSQKATRSRMEPEAPCPASIPSVERKFHVLV
GVTGSVAALKLPLLVSKLLDIPGLEVTVVTTERAKHFYSPQDVPVTLYSDADEWEMWKRR
SDPVLHIDLRRWADLMVVAPLDANTLGKVASGICDNLLTCVIRAWDLNKPLLFCPAMNTA
MWEHPLTAQQVGQLKAFGYVEIPCVSKKLVCGDQGLGAMAEVEIIVAKVKDVLFQHGGIQ
QS
Download sequence
Identical sequences D3ZZZ5
10116.ENSRNOP00000025289 NP_001102233.1.100692 XP_003750560.1.100692 XP_008764526.1.100692 XP_008764527.1.100692 XP_008764528.1.100692 XP_017459124.1.4139 XP_017459125.1.4139 XP_017459126.1.4139 ENSRNOP00000025289 ENSRNOP00000025289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]