SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025344 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000025344
Domain Number - Region: 19-67
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.0217
Family Inhibitor of apoptosis (IAP) repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025344   Gene: ENSRNOG00000018700   Transcript: ENSRNOT00000025343
Sequence length 81
Comment pep:known chromosome:Rnor_5.0:8:128025193:128122001:1 gene:ENSRNOG00000018700 transcript:ENSRNOT00000025343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQKVAKEGPRLSKNQKFSEHFSIHCCPPFTFLNSKREIVDRKYSICKSGCFYQKKEEDW
ICCACQKTRLRRRSRSTPRKK
Download sequence
Identical sequences NP_036852.1.100692 NP_036852.1.4139 ENSRNOP00000025344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]