SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025718 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025718
Domain Number 1 Region: 1820-2066
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.24e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 937-1072
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.94e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 412-536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000141
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 594-725
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 1095-1229
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000573
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 757-799
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000187
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 7 Region: 821-954
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000107
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 532-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000179
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 9 Region: 1225-1274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000121
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 260-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000444
Family EGF-type module 0.018
Further Details:      
 
Domain Number 11 Region: 291-419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000926
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 12 Region: 182-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000104
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 13 Region: 65-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000137
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 1306-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000566
Family EGF-type module 0.016
Further Details:      
 
Domain Number 15 Region: 1376-1416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000666
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 16 Region: 1264-1304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000911
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 17 Region: 1424-1456
Classification Level Classification E-value
Superfamily Notch domain 0.0000000955
Family Notch domain 0.0015
Further Details:      
 
Domain Number 18 Region: 716-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.018
Further Details:      
 
Domain Number 19 Region: 222-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 20 Region: 146-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000132
Family EGF-type module 0.024
Further Details:      
 
Domain Number 21 Region: 1503-1534
Classification Level Classification E-value
Superfamily Notch domain 0.000000222
Family Notch domain 0.0029
Further Details:      
 
Domain Number 22 Region: 108-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000639
Family EGF-type module 0.01
Further Details:      
 
Domain Number 23 Region: 1060-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000675
Family EGF-type module 0.016
Further Details:      
 
Domain Number 24 Region: 28-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000219
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000025718
Domain Number - Region: 1465-1497
Classification Level Classification E-value
Superfamily Notch domain 0.000641
Family Notch domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025718   Gene: ENSRNOG00000018835   Transcript: ENSRNOT00000025718
Sequence length 2471
Comment pep:known chromosome:Rnor_5.0:2:219662511:219793306:1 gene:ENSRNOG00000018835 transcript:ENSRNOT00000025718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALRPAALRALLWLWLCGAGPAHALQCRGGQEPCVNEGTCVTYHNGTGYCRCPEGFLGE
YCQHRDPCEKNRCQNGGTCVTQAMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGT
CHMLSWDTYECTCQVGFTGKQCQWTDVCLSHPCENGSTCSSVANQFSCRCPAGITGQKCD
ADINECDIPGRCQHGGTCLNLPGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTSECHCLPGFEGSNCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCLCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGTLCDENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCLHGACV
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCMCPEGPHHPSCYSQ
VNECLSSPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCNNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCLDDVSGYTCHCMLPYTGKNCQTVLAPCSPN
PCENAAVCKEAPNFESFTCLCAPGWQGQRCTVDVDECVSKPCMNNGICHNTQGSYMCECP
PGFSGMDCEEDINDCLANPCQNGGSCVDKVNTFSCLCLPGFVGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGP
FCLHDINECSSNPCLNSGTCVDGLGTYRCTCPLGYTGKNCQTLVNLCSPSPCKNKGTCAQ
EKARPRCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCAGGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLKNNYQCVCRSAFTGRHCETFLDVCPQKPCLNGGTCA
VASNVPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCVHTASGPHCFCLNRKDCESGCAS
NPCQHGGTCYPQRQPPYYSCRCSPPFWGSHCESYTAPTSTPPATCLSQYCADKARDGICD
EACNSHACQWDGGDCSLTMEDPWANCTSSLRCWEYINNQCDELCNTAECLFDNFECQRNS
KTCKYDKYCADHFKDNHCDKGCNNEECGWDGLDCAADQPENLAEGILVIVVLLPPEQLLQ
DSRSFLRALGTLLHTNLRIKQDSQGALMVYPYYGEKSAAMKKQKVARRSLPDEQEQEIIG
SKVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESEDPRNTPLLY
LLAVAVVIILFLILLGVIMAKRKRKHGFLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSTTSEHWGDDEGPQPKKAKAEDDEALLSEDDPVDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVLCGPNRSFLSLKHTPMG
KKARRPNTKSTMPTSLPNLAKEAKDVKGSRRKKCLNEKVQLSESSVTLSPVDSLESPHTY
VSDATSSPMITSPGILQASPTPLLAAAPAAPVHAQHALSFSNLHEMQPLAPGASTVLPSV
SQLLSHHHIVPPGSGSAGSLGRLHSVPVPSDWMNRVEMSETQYSEMFGMVLAPAEGTHPG
MAAPQSRAPEGKPIPTQREPLPPIVTFQLIPKGSLAQAAGAPQTQSGCPPAVAGPLPSMY
QIPEMARLPSVAFPPTMMPQQEGQVAQTIVPTYHPFPASVGKYPTPPSQHSYASSNAAER
TPNHGGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGGGGGQRGPGTHMS
EPPHSNMQVYA
Download sequence
Identical sequences G3V8G9
ENSRNOP00000025718 ENSRNOP00000046610 10116.ENSRNOP00000025718 NP_077334.2.100692 NP_077334.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]