SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026186 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026186
Domain Number 1 Region: 4-290
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-104
Family PAPS sulfotransferase 0.00000000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026186   Gene: ENSRNOG00000019342   Transcript: ENSRNOT00000026186
Sequence length 291
Comment pep:known chromosome:Rnor_5.0:1:205079584:205083124:-1 gene:ENSRNOG00000019342 transcript:ENSRNOT00000026186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQG
GKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVK
VIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRH
THPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIP
TEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
Download sequence
Identical sequences P17988
NP_114022.1.100692 NP_114022.1.4139 10116.ENSRNOP00000026186 ENSRNOP00000026186 ENSRNOP00000026186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]