SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026212 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026212
Domain Number 1 Region: 1862-2106
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-53
Family Ankyrin repeat 0.0000000566
Further Details:      
 
Domain Number 2 Region: 399-533
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 1170-1311
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000785
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 4 Region: 856-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000722
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 5 Region: 754-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000108
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 6 Region: 629-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000455
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 528-570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000481
Family EGF-type module 0.005
Further Details:      
 
Domain Number 8 Region: 791-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000155
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 983-1101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 10 Region: 141-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000201
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 603-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 295-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000104
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 13 Region: 1141-1184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000261
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 177-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000584
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 15 Region: 563-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000675
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 16 Region: 257-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family EGF-type module 0.016
Further Details:      
 
Domain Number 17 Region: 104-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000511
Family EGF-type module 0.026
Further Details:      
 
Domain Number 18 Region: 1308-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000967
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1489-1522
Classification Level Classification E-value
Superfamily Notch domain 0.000000115
Family Notch domain 0.0052
Further Details:      
 
Domain Number 20 Region: 1529-1561
Classification Level Classification E-value
Superfamily Notch domain 0.000000183
Family Notch domain 0.0043
Further Details:      
 
Domain Number 21 Region: 332-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 22 Region: 60-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000382
Family EGF-type module 0.02
Further Details:      
 
Domain Number 23 Region: 1390-1428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family EGF-type module 0.02
Further Details:      
 
Domain Number 24 Region: 1448-1480
Classification Level Classification E-value
Superfamily Notch domain 0.00000106
Family Notch domain 0.00018
Further Details:      
 
Domain Number 25 Region: 219-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 26 Region: 1112-1149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000347
Family EGF-type module 0.022
Further Details:      
 
Domain Number 27 Region: 1345-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000122
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000026212
Domain Number - Region: 374-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000272
Family EGF-type module 0.097
Further Details:      
 
Domain Number - Region: 25-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000534
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 832-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0101
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026212   Gene: ENSRNOG00000019322   Transcript: ENSRNOT00000026212
Sequence length 2531
Comment pep:known chromosome:Rnor_5.0:3:9266672:9311575:-1 gene:ENSRNOG00000019322 transcript:ENSRNOT00000026212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRLLAPLLCLTLLPALAARGLRCSQPSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDP
SPCLSTPCKNAGTCYVVDHGGIVDYACSCPLGFSGPLCLTPLANACLANPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICGCPPGFHGPTCRQDVN
ECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTT
HECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNSHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGA
NPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMP
GYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGLCKDGVATFTCLCQPGYTGHHC
ETNINECHSQPCRHGGTCQDRDNYYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKID
GYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNEC
NSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKN
SGVCKESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHGASCQNTNGSYRCLCQAGYT
GRNCESDIDDCRPNPCHNGGSCTDGVNAAFCDCLPGFQGAFCEEDINECASNPCQNGANC
TDCVDSYTCTCPTGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQY
DVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGKCWQTNTQ
YHCECRSGWTGFNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEEDKHYCHCQAGYTGS
YCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCID
LTNTYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFV
GERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVINGCRGKPCRNGG
VCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTG
PECQFPASSPCVGSNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFTGGAGRDI
PPPQIEEACELPECQEDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYY
GREEELRKHPIKRSAVGWATTSLLPGTNGGRQRRELDPMDIHGSIVYLEIDNRQCVQSSS
QCFQSATDVAAFLGALASLGSLNIPYKIEAVKSETVEPPLPSQLHLMYVAAAAFVLLFFV
GCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQ
NEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRVSAMAPTPPQGEVDAD
CMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGET
ALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILLRNRATDLDA
RMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKN
GANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV
RLLDEYNLVRSPQLHGTALGGTPTLSPTLCSPNGYLGNLKSATQGKKARKPSTKGLACSS
KEAKDLKARRKKSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMP
LSHLPGMPDTHLGISHLNVAAKPEMAALAGGSRLAFEPPPPRLSHLPVASSASTVLSTNG
TGAMNFTVGAPASLNGQCEWLPRLQNGMVPSQYNPLRPGVTPGTLSTQAAGLQHGMMGPI
HSSLSTNTLSPIIYQGLPNTRLATQPHLVQTQQVQPQNLQIQPQNLQPPSQPHLSVSSAA
NGHLGRSFLSGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSMVPPMTTTQFLTPP
SQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTSMP
SQITHIPEAFK
Download sequence
Identical sequences Q07008
NP_001099191.1.100692 NP_001099191.1.4139 ENSRNOP00000026212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]