SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026457 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026457
Domain Number 1 Region: 309-657
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.7e-124
Family PDEase 0.0000000000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026457   Gene: ENSRNOG00000019518   Transcript: ENSRNOT00000026457
Sequence length 671
Comment pep:known chromosome:Rnor_5.0:16:20299675:20318027:-1 gene:ENSRNOG00000019518 transcript:ENSRNOT00000026457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSGTTLSFLLTERVREPVDSGVAPVSHLGGGVILRRFSGTLLLPPLSSRLGSSGEAES
AAPVVFTIGSRGTERSHGSAQSSFDLENGLPSGRGPLDAQSGSSLGRALQPPVHHGQRRE
SFLYRSDSDHEPSPKAVSRTSSAASDLHGEDMIVTPFAQVLASLRTVRSNVAALAHGAGS
ATRQALLGTPPQSSQQAAPAEESGLQLAQETLEELDWCLEQLETLQTRRSVGEMASNKFK
RMLNRELTHLSETSRSGNQVSEYISQTFLDQQAEVELPAPPTEDHPWPMAQITGLRKSCH
TSLPTAAIPRFGVQTDQEEQLAKELEDTNKWGFDVFKVAELSGNRPLTAVIFSVLQERDL
LKTFQIPADTLLRYLLTLEGHYHSNVAYHNSIHAADVVQSAHVLLGTPALEAVFTDLEVL
AAIFACAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQGENCDIFQN
LSTKQKLSLRRMVIDMVLATDMSKHMSLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQ
SLVHCADLSNPAKPLPLYRQWTERIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVG
FIDYIAHPLWETWADLVHPDAQELLDTLEDNREWYQSRVPCSPPHAIGPDRFKFELTLEE
TEEEEEEDERH
Download sequence
Identical sequences G3V8J8
ENSRNOP00000026457 10116.ENSRNOP00000026457 ENSRNOP00000026457 NP_001263694.1.100692 NP_001263694.1.4139 XP_006252930.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]