SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026499 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026499
Domain Number 1 Region: 63-133
Classification Level Classification E-value
Superfamily Ribosomal protein S18 4.97e-22
Family Ribosomal protein S18 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026499   Gene: ENSRNOG00000019511   Transcript: ENSRNOT00000026499
Sequence length 196
Comment pep:known chromosome:Rnor_5.0:9:16133559:16150048:-1 gene:ENSRNOG00000019511 transcript:ENSRNOT00000026499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRALVSGCGRQLQTLLAGPAATGWLWLPARGLREVVKIQEGKTTVIEGRVTESPKAT
PDPPNPSGQCPICRWNLKHKYNYEDVLLLSQFIRPHGGMLPRRITGLCREEHRKMEECVK
MAHRAGLFPNHRPRLPEGCSPKDKPKLNRYLTRWAPKSVKPIYKKGHPWNKVGMAVGSPL
LKDNVRYSRRPLKLMH
Download sequence
Identical sequences Q6PDU2
ENSRNOP00000026499 NP_942051.1.100692 NP_942051.1.4139 10116.ENSRNOP00000026499 ENSRNOP00000026499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]