SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026586 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026586
Domain Number 1 Region: 576-920
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.16e-109
Family PDEase 0.00000216
Further Details:      
 
Domain Number 2 Region: 391-571
Classification Level Classification E-value
Superfamily GAF domain-like 1.94e-48
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 221-402
Classification Level Classification E-value
Superfamily GAF domain-like 2.18e-35
Family GAF domain 0.0000000104
Further Details:      
 
Domain Number 4 Region: 43-201
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000118
Family GAF domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026586   Gene: ENSRNOG00000019560   Transcript: ENSRNOT00000026586
Sequence length 935
Comment pep:known chromosome:Rnor_5.0:1:172724783:172816712:1 gene:ENSRNOG00000019560 transcript:ENSRNOT00000026586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG
LRQAAKDALSAVLPKVETVYTYLVDGESRLVCEDPPHELPQEGKIREAVISRKRLSCDGL
GPSDLLGKPLARLVAPLAPDTQVLVIPLLDKETGTVAAVILVHCGQLSDSEEQSLQVVEK
HALVALQRVQALQQRRPEAVQNTSADPSEDQKDEKGYTAHDRKILQLCGELYDLDATSLQ
LKVLRYLQQETQATHCCLLLVSEDNLQLSCKVIGEKVLGEEVSFPLTMGRLGQVVEDKQC
IQLKDLTSDDVQQLQNMLGCELRAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDERA
IQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLS
NAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHP
LFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCG
ISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTY
TPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVS
HFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSV
MERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAE
VGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPM
EMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIR
GLPSNNSLDFLDEEYEVPDLDVTRAPVNGCCSLEG
Download sequence
Identical sequences F8WFW5
ENSRNOP00000047190 NP_001137319.1.100692 NP_001137319.1.4139 ENSRNOP00000026586 10116.ENSRNOP00000026586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]