SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Rattus norvegicus 76_5.0 > ENSRNOP00000026661

Domain assignment for ENSRNOP00000026661 from Rattus norvegicus 76_5.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSRNOP00000026661
Domain Number 1	Region: 100-134
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.000000000576
Family	CCCH zinc finger	0.00025
Further Details:

Domain Number 2	Region: 137-168
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.0000000017
Family	CCCH zinc finger	0.00063
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSRNOP00000026661 Gene: ENSRNOG00000019673 Transcript: ENSRNOT00000026661
Sequence length	326
Comment	pep:known chromosome:Rnor_5.0:1:86595418:86597898:1 gene:ENSRNOG00000019673 transcript:ENSRNOT00000026661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAIRATMDLSAIYESLMSMSHDLSPDHGGTESSGGLWNINSSDSIPSGVTSRLTGRSTSL VEGRSCSWVPPPPGFAPLAPRPGPELSPSPTSPTATPTTSSRYKTELCRTYSESGRCRYG AKCQFAHGPGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPTEDLALPGQPHVL RQSISFSGLPSGRRTSPPPPGFSGPSLSSCSFSPSSSPPPPGDLPLSPSAFSAAPGTPVS RRDPTPACCPSCRRSTTPSTIWGPLGGLARSPSAHSLGSDPDDYASSGSSLGGSDSPVFE AGVFGPPQPPAPPRRLPIFNRISVSE
Download sequence
Identical sequences	G3V8K6 10116.ENSRNOP00000026661 ENSRNOP00000026661 ENSRNOP00000026661 NP_579824.2.100692 NP_579824.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]