SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026676 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000026676
Domain Number - Region: 169-215
Classification Level Classification E-value
Superfamily TIMP-like 0.0369
Family Netrin-like domain (NTR/C345C module) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026676   Gene: ENSRNOG00000019692   Transcript: ENSRNOT00000026676
Sequence length 291
Comment pep:known chromosome:Rnor_5.0:10:14977382:14979400:-1 gene:ENSRNOG00000019692 transcript:ENSRNOT00000026676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVAALLCALCCGLLAASARAGYSEDRCSWRGSGLTQEPGSVGQLTLDCTEGAIEWLYPA
GALRLTLGGSDPGTRPSIVCLRPTRPFAGAQVFAERMAGNLELLLAEGQGLAGGRCMRWG
PRERRALFLQATPHRDISRRVAAFQFELHEDQRAEMSPQAQGFGVDGACRPCSDAELLLT
ACTSDFVIHGTIHGVVHDMELQESVITVVATRVIRQTLPLFQEGSSEGRGQASVRTLLRC
GVRPGPGSFLFMGWSRFGEAWLGCAPRFQEFSRVYSAALAAHLNPCEVALD
Download sequence
Identical sequences Q5Q0T9
ENSRNOP00000026676 NP_001009962.1.100692 NP_001009962.1.4139 10116.ENSRNOP00000026676 ENSRNOP00000026676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]