SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026807 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026807
Domain Number 1 Region: 7-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.19e-83
Family Eukaryotic proteases 0.0004
Further Details:      
 
Domain Number 2 Region: 435-541
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-27
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 3 Region: 316-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-20
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026807   Gene: ENSRNOG00000019794   Transcript: ENSRNOT00000026807
Sequence length 608
Comment pep:novel chromosome:Rnor_5.0:1:179007230:179027399:-1 gene:ENSRNOG00000019794 transcript:ENSRNOT00000026807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPISKDKLILILGIVCLEQGHSATLSSIRAPDCGKSLVKPWPQNYFSLFSRIVGGSQVEK
GSYPWQVSLKQKQKHICGGTIISSQWVITAAHCMANRNIALTLNVTAGEHDLSQAEPGEQ
TLAIETIIIHPQFSTKKPMNYDIALLKMVGTFQFGQFVRPVCLPEPGEQFNAGYICTTAG
WGRLSEGGSLPQVLQQVNLPILTHEECEAVMLTLRNPITGKTFLCTGSPDGGRDACQGDS
GGSLMCQNRKGAWTLAGVTSWGLGCGRSWRNNARKKEQGSPGIFTDLRRVLPWIHEHVQT
GHRRKSTKASCSELDGLISGSEGELHFPESLHLYYESKQLCVWTFLVPEDMHMLFNLSHL
DVESCHHNYLAMYSLEDRLVGKFCGESLPSSILIGSSSIQLRFISDATDYATGFNLTYKA
LKPSYHPDSGCRSLTILFEEGTIQSLHYPEEYSDMASCTWIFQAPNHFLIKLSFQSLEIE
ENGDCTSDYVTVYSDVERENEIARFCGYEVPSPVLSSSVMLINFQSDENGTSRGFQADVS
FISRADFNISISEDESVPLETWDVPLAMEISGKLNPLGTQTPYEEEDTDGTPAIDGDLLK
QGKRYGKH
Download sequence
Identical sequences D4A7R5
10116.ENSRNOP00000026807 ENSRNOP00000026807 ENSRNOP00000061887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]