SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027123 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000027123
Domain Number - Region: 37-105
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00209
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027123   Gene: ENSRNOG00000019940   Transcript: ENSRNOT00000027123
Sequence length 183
Comment pep:known chromosome:Rnor_5.0:2:207354107:207362738:1 gene:ENSRNOG00000019940 transcript:ENSRNOT00000027123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLVVVVLALLAVSQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELS
DDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPV
VIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKP
KKN
Download sequence
Identical sequences B5DEQ0
ENSRNOP00000027123 NP_001099912.1.100692 NP_001099912.1.4139 10116.ENSRNOP00000027123 ENSRNOP00000027123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]