SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027320 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027320
Domain Number 1 Region: 65-370,451-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.81e-65
Family FAD-linked reductases, N-terminal domain 0.0000939
Further Details:      
 
Domain Number 2 Region: 355-461
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.64e-25
Family L-aminoacid/polyamine oxidase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027320   Gene: ENSRNOG00000020148   Transcript: ENSRNOT00000027320
Sequence length 642
Comment pep:known_by_projection chromosome:Rnor_5.0:1:101894734:101901347:1 gene:ENSRNOG00000020148 transcript:ENSRNOT00000027320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARRAPQRPACTLHLVLVATLLGLAVSLQWRAASNLNLIEKCMVDHDYEQLLKVVTLGL
NRTSKPQKVVVVGAGVAGLVAAKVLSDAGHKVTILEAGNRIGGRIFTFRDEKTGWIGELG
AMRMPSSHRILHQLCRSLGLNLTQFTQYDENAWTEVKGVKLRNYVVEKMPEKLGYDLNHR
ERGHSPEDIYQMALNKAIKDVKVLGCKKAMNMFSEHTLLEYLLKEGNLSQPAVQLLGDVM
SKEGFFYLSLAEAFRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGTVLLNAPVVSISQG
RHEVHVHFTTSLQSHSLEVMTADVVLLTASGPALQRISFSPPLTRKRQEALRALHYVAAS
KVFLSFHRPFWHEEHIMGGHSNTDRPSRLIFYPAPGEGSLLLASYTWSDAAAPFAGLSTE
QTLHLVLKDLAALHGPVVYRLWDGRGVVKRWAEDPYSQGGFVVQPPLFGQGTEDYDWSVP
YGRIYFAGEHTALPHGWVETAVKSGLRAALRINSNYGYGMVDLETLEHALAEASFAEQYL
EGDQPEEQQAQEEVNPDRQDLSQKHLLVETGPDGQQHVFVENIPEPLEHVFMKTNPQEKG
HKHQIIYPSEHGHVHGEVIPEGKHGHVGSGTLQHMHGEVDHS
Download sequence
Identical sequences 10116.ENSRNOP00000027320 ENSRNOP00000053202 ENSRNOP00000027320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]