SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027418 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027418
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily SRP19 2.49e-39
Family SRP19 0.000000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027418   Gene: ENSRNOG00000020204   Transcript: ENSRNOT00000027418
Sequence length 144
Comment pep:known chromosome:Rnor_5.0:18:26828311:26834643:1 gene:ENSRNOG00000020204 transcript:ENSRNOT00000027418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPINKAVENPTATEIQDVCSAVGLNA
FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTRTQ
KSGGADPSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences B2RZ66
ENSRNOP00000027418 NP_001099627.1.100692 NP_001099627.1.4139 ENSRNOP00000027418 10116.ENSRNOP00000027418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]