SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027620 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027620
Domain Number 1 Region: 7-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-41
Family Galectin (animal S-lectin) 0.00000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027620   Gene: ENSRNOG00000020380   Transcript: ENSRNOT00000027620
Sequence length 136
Comment pep:known chromosome:Rnor_5.0:1:88226424:88227839:1 gene:ENSRNOG00000020380 transcript:ENSRNOT00000027620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQATHHKTPLPQGVRLGTVMRIRGVVPDQAGRFHVNLLCGEEQEADAALHFNPRLDTSEV
VFNTKQQGKWGREERGTGIPFQRGQPFEVLIITTEEGFKTVIGDDEYLHFHHRMPSSNVR
SVEVGGDVQLHSVKIF
Download sequence
Identical sequences ENSRNOP00000027620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]