SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028047 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028047
Domain Number 1 Region: 97-252
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.19e-31
Family AlaX-like 0.028
Further Details:      
 
Domain Number 2 Region: 2-96
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000053
Family AlaX-M N-terminal domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028047   Gene: ENSRNOG00000020658   Transcript: ENSRNOT00000028047
Sequence length 412
Comment pep:known chromosome:Rnor_5.0:10:89115999:89129102:-1 gene:ENSRNOG00000020658 transcript:ENSRNOT00000028047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLCQRDSYAREFTTTVVSCCPAELQTDGNGSKKEVLSGFQVVLEDTLLFPEGGGQPDD
RGTINDISVLRVTRRGAQADHFTQTPLSPGSQVQVRVDWERRFDHMQQHSGQHLITAVAD
LLFGLKTTSWELGKLRCVIELDSPSVTAEQVAAIEQSVNQKIRDRLPVSVRELSLDDPEV
EQVRGRGLPDDHAGPIRVVTIEGVDSNMCCGTHVNNLSDLQVIKILGTEKGKKNKSNLIF
LAGNRVLKWMERSHGSEKALTSLLKCGAEDHVEAVKKLQNATKLLQKNNLNLLRDLAVHT
AHTLRSSPAWGGVVTLHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPTE
AVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRAEVQALLQDYVSTQSAEE
Download sequence
Identical sequences Q5XI97
NP_001029281.1.100692 NP_001029281.1.4139 ENSRNOP00000028047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]