SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028272 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028272
Domain Number 1 Region: 263-595
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.25e-121
Family PDEase 0.000000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028272   Gene: ENSRNOG00000020828   Transcript: ENSRNOT00000028272
Sequence length 761
Comment pep:known chromosome:Rnor_5.0:8:22242476:22289441:1 gene:ENSRNOG00000020828 transcript:ENSRNOT00000028272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRKRLTLPRIFIVRKNGNSLEAENGPTPSPGRSPLDSQASPGLVLHAGATTSQRRESF
LYRSDSDYDMSPKAVSRSSSVASEAHAEDLIVTPFAQVLASLRSVRSNFSLLTNVPIPSN
KRSPLGGPPSVCKATLSEETCQQLARETLEELDWCLEQLETMQTYRSVSEMASHKVNPLV
DRALSRVTEVGRTSGQDDDLISRSLTDKQNEVEIPSPTPRQRAFQQPPPSVLRQSQPMSQ
ITGLKKLVHTGSLNTNVPRFGVKTDQEDLLAQELENLSKWGLNIFCVSEYAGGRSLSCIM
YTIFQERDLLKKFHIPVDTMMMYMLTLEDHYHADVAYHNSLHAADVLQSTHVLLATPALD
AVFDLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQE
ENCDIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTMVETKKVTSSGVLLXDTP
SHIQVLRNMVHCADLSNPTKPLELYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTAS
VEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNRDWYHSAIRQSPSPPLEEEPGG
LGHPSLPDKFQFELTLEEEEEEDSLEVPGLPTTEETFLAAEDARAQAVDWSKVKGPSTTV
VEVAERLKQETASAYGAPQESMEAVGCSFSPGTPILPDVRTLSSSEEAPGLLGLPSTAAE
VEAPRDHLAATRACSACSGTSGDNSAIISTPGRWGSGGDPA
Download sequence
Identical sequences ENSRNOP00000028272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]