SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028628 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028628
Domain Number 1 Region: 135-254
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.29e-26
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000366
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000028628
Domain Number - Region: 274-296
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000314
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028628   Gene: ENSRNOG00000021085   Transcript: ENSRNOT00000028628
Sequence length 639
Comment pep:known chromosome:Rnor_5.0:1:228723306:228735808:1 gene:ENSRNOG00000021085 transcript:ENSRNOT00000028628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIED
LTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALN
PDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGK
GSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLR
KMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP
QSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPASNPPPPSLMS
TTQSRPPWMNSGPSENRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP
PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPP
PPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQNTTTTTTSAGTGS
IPPWQQQQAAAAASPGTPQMQGNPTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMYAPP
PPPPPPMDPSNFVTMMGMGVAGMPPFGMPPAPPPPPPQN
Download sequence
Identical sequences F1LSC3 Q3UI45
ENSMUSP00000121309 ENSRNOP00000028628 NP_001104261.1.92730 NP_001104263.1.100692 NP_001104263.1.4139 XP_006230703.1.100692 XP_021064922.1.100879 ENSMUSP00000109113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]