SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000029263 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000029263
Domain Number 1 Region: 4-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-30
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 2 Region: 133-311
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000038
Family Pentraxin (pentaxin) 0.0028
Further Details:      
 
Domain Number 3 Region: 795-1074
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000384
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000029263   Gene: ENSRNOG00000011411   Transcript: ENSRNOT00000030511
Sequence length 1129
Comment pep:known_by_projection chromosome:Rnor_5.0:1:10203643:10274931:-1 gene:ENSRNOG00000011411 transcript:ENSRNOT00000030511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCGNCRLVLSNPSGTFTSPCYPNDYPNTQSCSWTLRAPTGYIIQITFNDFDIEEAPNCIY
DSLSLDNGESQTKFCGATAKGLSFNSSVNEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQ
KVILPQTLDAYQVSVAKSISIPELKAFTLCFEASKVGNEDDDWTAFSYSDKSLTQLLSLE
KANNGYFLSISGARCLLNNALPVKEKEDIFTGNFEQLCLVWNNSWGSVGINFKKNYETIP
CDLTIGTVVPGDGTLLLGSDRDEIASLKGSVYNFRLWNFTMDPKSLSNLSCSMSGNVIDW
HNDFWSISTQALKAENNLSCGSYLIPLPAAELTNCSDLGTLCQDGIMYRISVVIHNDLNH
PEVRVQSKVAEWLNATFQNWNYTVYVVNISFHQDLGEDRMKVKRDVMDDDKRLVLWALLV
YNATNNVSLNGEMIEQKLSANNASLEDGIRLCKVDVKQLGMCNTLGDPEGFKWTAISPSV
YKQPCPNKPGFFMMRTCLCNETSTFWGPIDASNCSRQSNEVANEILDLTGDGQNLTSANI
NSIVEQVKRIVNKEENIDRTLGSTLMNIFSNILSSSDSNLLESSTEALKTIDELAFKIDL
NSTPHVNIETQNLALGVSSLMPGTNAPSNFSIGLPSNNDSYFQMDFENGQADPLASVILP
PNLLENLSPEDSILVRRAQFTFFNKTGLFQDVGSQRKILVSYVMACSIGNITIQNLKDPV
QIKIKHTRTQEVHQPICAFWDLNQNKSFGGWNTSGCVAHSDSDAGETICLCNHFTHFGVL
MDLPRSASQIDGRNTKVLTFITYIGCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSS
ALLFLNLIFLLDGWITSFGVAGLCTAVAALLHFFLLATFTWMGLEAIHMYIALVKVFNTY
IHRYILKFCIIGWGLPALVVSIILVSRKQNEVYGKESYGKDQDDEFCWIQDPVVFYVSCA
GYFGIMFFLNVAMFIVVMVQICGRNGKRSNRTLREEVLRNLRSVVSLTFLLGMTWGFAFF
AWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKENVQKQWRRHLCCGRFRLADNSDWSKTA
TNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSHSGNFS
Download sequence
Identical sequences ENSRNOP00000029263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]