SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000029515 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000029515
Domain Number 1 Region: 4-551
Classification Level Classification E-value
Superfamily SIS domain 4.45e-231
Family Phosphoglucose isomerase, PGI 0.0000000000000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000029515   Gene: ENSRNOG00000023150   Transcript: ENSRNOT00000032613
Sequence length 558
Comment pep:known chromosome:Rnor_5.0:1:91207017:91234890:-1 gene:ENSRNOG00000023150 transcript:ENSRNOT00000032613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTRNPEFQKLLEWHRANSANLKLRELFEADPERFNHFSLNLNTNHGHILLDYSKNLV
NKEVLHMLVDLAKSRGVEAARDNMFSGLKINSTEDRAVLHVALRNRSNRSIMMDGKDVMP
EVNKVLDKMKSFCQRVRSGDWKGYTGKAITDIINIGIGGSDLGPLMVTEALKPYSKGGPR
VWFVSNIDGTHIAKTLANLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTDKVKEFGIDPKNMFEFWDWVGGRYSLWSAIGLSIALHVGFDHFEQLLSGA
HWMDQHFMKTPLDKNAPVLLALLGIWYINFYGCETHAMLPYDQYMHRFAAYFQQGDMESN
GKYITKSGARVDYQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRNGL
HHKILLANFLAQTEALMKGKSPEEARKELQAAGKSPEELEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSSAVTSHDS
STNGLIGFIKLQRDTKID
Download sequence
Identical sequences Q6P6V0
NP_997475.1.100692 NP_997475.1.4139 ENSRNOP00000029515 ENSRNOP00000029515 10116.ENSRNOP00000029515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]