SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030107 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030107
Domain Number 1 Region: 25-127
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-33
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 2 Region: 184-289
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-26
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 3 Region: 132-200
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.73e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030107   Gene: ENSRNOG00000007057   Transcript: ENSRNOT00000036029
Sequence length 297
Comment pep:novel chromosome:Rnor_5.0:5:150394968:150411673:1 gene:ENSRNOG00000007057 transcript:ENSRNOT00000036029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTVRRWNYPPPLCIAQCGGAVEEMEGVILSPGFPGNYPSNMDCSWKISLPVGFGAHIQ
FLNFSTEPNHDFLEIRSGPSETSRMMGRFSGSELPGSLLSTSHDTIVYFHSDHSQNRPGF
KLEYQAYELQECPDPEPFANGIVRGAGYNVGQSVTFECLPGYQLTGQPVLTCQHGTNRNW
DHPLPRCEVPCGGNITSFNGTVYSPGYPSPYSSSQDCVWQITVPIGHGVHLNLSLLQIEP
FGDYITVWDGPQQTSLQLGVFTRSLSKKIAYSSSNQVLLKFHRDTATGGIFAIAFTG
Download sequence
Identical sequences ENSRNOP00000030107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]