SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030200 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030200
Domain Number 1 Region: 553-710
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.16e-41
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.012
Further Details:      
 
Domain Number 2 Region: 423-552
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.18e-30
Family Poly(A) polymerase, PAP, N-terminal domain 0.021
Further Details:      
 
Domain Number 3 Region: 80-189
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.22e-21
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.069
Further Details:      
 
Domain Number 4 Region: 12-74
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000458
Family Poly(A) polymerase, PAP, N-terminal domain 0.059
Further Details:      
 
Domain Number 5 Region: 730-761
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000907
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Domain Number 6 Region: 777-805
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000314
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000030200
Domain Number - Region: 384-408
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000147
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030200   Gene: ENSRNOG00000009720   Transcript: ENSRNOT00000033886
Sequence length 1073
Comment pep:known chromosome:Rnor_5.0:5:131941061:132009237:1 gene:ENSRNOG00000009720 transcript:ENSRNOT00000033886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQGITDDDLRIRQDIVEEMSKVIVTFLPALYVDVESDFHAKVPVVVCKDRKSGLLCRVSA
GNDMACLTTDLLAALGKVEPVFTPLVLAFRYWAKSPLTLEAPNQVPLGQLWLELLKFYTL
DFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSLNSQLVYEYVVERFRA
AYRYFACPQRKGGNKSTVDLKKKEKGKLSNKKPVKSDCSATNGCVLGESTEKVNMERGQP
LKHDEMEFTSQRCIVDNDRLLVNELGLADHGQDSSSLSTGSEGSELQQKSAEKQGDLTPS
ETSLKKELSQCHCTGTPDGAGSAGTDCRSNLEMESSHQIVCNNISATSCNCKATEVASDL
IDDDNLPSQELYYVFDKFILTSGKPPTIVCSICKKDGHSKNDCPEDFRKIDLKPLPPMTN
RFREILDLVCKRCFDELSPPCSEQHNREQILIGLEKFIQKEYDEKARLCLFGSSKNGFGF
RDSDLDICMTLEGHENAEKLNCKEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHRRS
GLEGDISLYNTLRCDIGDASRGSLSSYAYILMVLYFLQQRKPPVIPVLQEIFDGKQIPQR
MVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLL
TTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAFINGRKLFGTPFYPLIGREAE
YFFDSRVLTDGELAPNDRCCRVCGKIGHYMKDCPKRKRLKKKDSEEEKEGNEEEKDSRDL
LDSRDLRCFICGDAGHVRRECPEVKMARQRNSSVAAAQLVRNLVNAQQVAGSAQQQSDQS
IRTRQSSECSDSPSYSPQPQPFPQNSPQPSALPPPPSQPGSQPKLGPPQQGGQPPHQVQM
PLYNFPPSPPAHYSPMHGMGLLPMHPLQIPAPSWPIHGPMLHSAPGSTPSNIGLNDPSII
FAQPAARPMAIPSSSHDGHWPRTVAPNSLVNNGAVGNSEPRFRGLNPPIPWEHAPRPHFP
LVPASWPYGLHQNFMHQGNPRFQPKPFYAQAERCATRRSRERCPHPPRGNVSE
Download sequence
Identical sequences ENSRNOP00000030200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]