SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030332 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030332
Domain Number 1 Region: 272-406,714-887
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 9.81e-52
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 6-127
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-27
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 3 Region: 1099-1165
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.43e-19
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 173-242
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.41e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000261
Further Details:      
 
Domain Number 5 Region: 112-169
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000329
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030332   Gene: ENSRNOG00000023238   Transcript: ENSRNOT00000035338
Sequence length 1172
Comment pep:known chromosome:Rnor_5.0:9:94730643:94790627:1 gene:ENSRNOG00000023238 transcript:ENSRNOT00000035338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IREMTILKEGMLTKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESST
KNVNNSFTVITPCRKLILCADNRKEMEDWIAALKTVQNKEHFEPTQYSMDHFSGTHNWYA
CSHARPTYCNVCREVLSGVTSHGLSCEVCKFKAHKRCAVRATSNCKWTTLASIGKDIIED
EDGIAMPHQWLEGNLPVSAKCIVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLVMKCPL
GLCKVSVIPPTALNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNP
AQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGT
GNDLARVLGWGSACDDDTQLPQILAKLERASTKMLDRWSVMAYETKLPRQASSSTVTEDC
SEDSEVQQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTES
SQESEVMAKKCSVLKEKLDSLLKTLDDESQASSSLSNPPPTIAEEAEDGDGSGNICSSTG
DHLVGSACPSRPQIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQQGFVLGL
SESEKKDLKTDNRVCTSSAHSESCVVAKGRSHRKASRTPCEKLMSKGLSLGSSASLPPNT
GSRDSLPALNTKILYPSVRAGMSGSLPGGSVISRLLINADPFNAEPENLEYYTEKCVMNN
YFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYRNLEQKVLLECD
GRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVS
RVIKLQHHRIAQCRTVKISILGDEGVPVQVDGEAWIQPPGYIRIVHKNRAQTLTRDRAFE
NTLKSWEDKQKCELPRPPSFSLHPEILSEEEATQMDQFGQAAGSLIHSIREIAQSHRDME
QELAHAVNASSKAMERVYGKPRAAEGLNCSFVLEMVNNIRALRSETELLLAGKMALQLDP
PQKERLGAALVEMDQQLRKLTDTPWLCQPMEPGEEESLQQNVMLDLTKRSRSGKFRLVTK
FKKEKNNKNKEVHSYLGAPVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERR
DLKDLGVTKVGHMKRILCGIKELSRSSPAAEA
Download sequence
Identical sequences 10116.ENSRNOP00000030332 ENSRNOP00000030332 ENSRNOP00000030332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]