SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030441 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030441
Domain Number 1 Region: 961-1088
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000425
Family GAF domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000030441
Domain Number - Region: 313-403,800-843
Classification Level Classification E-value
Superfamily EF-hand 0.000151
Family Polcalcin 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030441   Gene: ENSRNOG00000022536   Transcript: ENSRNOT00000030805
Sequence length 1431
Comment pep:known_by_projection chromosome:Rnor_5.0:10:62678113:62783653:1 gene:ENSRNOG00000022536 transcript:ENSRNOT00000030805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSAGPIKDSLAVSKNVVLKKPVKVILGIDESDLKSKGQLPWKKNLNLKIEKRAQAMHQKV
LENENLKKEQEKVTKKLPRDELAKEWFNTESMTLNTRAYLLDKLLPTLIPGVEQMLMQVE
KKKLLSQADIPSKFDPINYLGEYLMRHNTHYIKDPGMSGYQRVMKEVTEELKIHVPDTIN
NRISKMKERVKQKREQREYISTVKVKVATMRKQALEEQFNEWILNPKGMIPIVVIQNVLY
DFFQKPELHLESRCKDLIIMKSVEPGLTQHQFVQYISSYIMDLKSEVFEEFLKHLCHCAE
EFREIITTDMRRQMFAELFLYCDSGKVMALDRQRTLALLEAFFDKTSSTTRSLLRNPRQW
PFVEFEEIELTEFWGDMDIKKHIYENFDELLLKMNMLAAEKLSGKLTEDKDKNLSQPQEE
ISTDQELSPELATEPGTATQETAKQKTHRASLKEQGQGIGLRKPSTSRQRLSRGSVAEQG
SRRGSVVNQTQQRGSVAQQGSRRSSGVNQTQQRGSVAEQGSRRSSGVNETQQRETVAEQG
SRRISTAEQEPQTEGSVIDQGQRRASGVSENGPYQESIKEEPLGESEHGPQIDTIQEQDA
DSAPQLEEGGTLEESKTLESNIVKSQEKKPSLLTHEKQVPMDSEQQREEVPTSSKKERPP
GTSKKDSQKDKACEPKPQHIEGKKWLGEFLMSDWKMKYIKSEDEEQAKLICDDSRFTDLH
ATIRSFQTYKGIKGRSAFDGVSLDLLQFVQLLETFVGEDTSLSVSQSLVSFFQKNFSETK
QEKIKALEQARRNSFQVRRKILLEALFEKWDNDGSGFLDLNEIDDLLYTYKEGMERESMK
KAKLHINFPKPSPGHEVKLSSKQFQRYIELVVSELRGNEDQVLENVVEFLMSSLERTHTE
GLRNCARRKWLHQIQHAAETSGVSLEPVYTETFRALTQDAEAHGNKKISAHISLLEENVL
LPERGHVLLRNVACTLDDAPFVLNKVLYRDMKGISFTVVDEGKPIHVPQVQHHGNIFFWN
STRSKNEQNGSFLALPLQDAYMRIFGVLAVDTLRDPREINIFLPHEIRFYQGVANAFSAA
YHYVHSREHILHTVLTGIRWLFGITAGITTITMCFTEPSSEQEEDYVLRNMMLTDHLGVA
EIHADPPTISRRACIFRDFLFKCTDTSEVILASSGGETHIAIPLRQISGEAIGVLDVNIG
RSRMLVYQEYKDLQKMMKMIQNVSYEILGEVSGEIEKQMVLEMEVAGEVKRAAILFFRTM
LQDLRGCLRLLDSMEFVSLLLYEHKHSVDFLQEDLSPQEVEANVTLIHDILKGVILFSQQ
DKDPFRDLEEWERWKFHINKYLVEEICALDPTASNVEINVELITRYIQDHSRTQVWKFKN
IVIELLYHWISICLTLIELNTQQDSFIVPPLPKKSTTTIYAMSSERSFREK
Download sequence
Identical sequences ENSRNOP00000030441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]