SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030575 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030575
Domain Number 1 Region: 744-931
Classification Level Classification E-value
Superfamily Sec7 domain 2.09e-64
Family Sec7 domain 0.00000725
Further Details:      
 
Domain Number 2 Region: 947-1078
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000209
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030575   Gene: ENSRNOG00000003466   Transcript: ENSRNOT00000038211
Sequence length 1471
Comment pep:novel chromosome:Rnor_5.0:X:64287088:64367249:-1 gene:ENSRNOG00000003466 transcript:ENSRNOT00000038211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSGPPGGPGSESPNRAVEYLLELNNIIESQQQLLETQRRRIEELEGQLDQLTQENRD
LREESQLHRGELHRDPLGARDSPGRESQYQNLRETQFHHRELRESQFHQASRDVGYPNRD
GAYQNREAIYRDKEREASYQLQDTTGYTARERDVAQCHLHHENPALGRERGGREAGPAHP
GREKEAGYSAAVGVGQRPPRERGQLSRGASRSSSPGAGGGHSTSTSTSPATTLQRNVEGD
APGSDLSTAVDSPGSQPPYRLSQLPPTSSHMGGPPAGVGLPWSQRARLQPASVALRKQEE
EEIKRSKALSDSYELSTDLQDKKVEMLERKYGGSFLSRRAARTIQTAFRQYRMNKNFERL
RSSASESRMSRRIILSNMRMQFSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGL
PYGGSCGGGIDGGGSSVTTSGEFSNDITELEDSFSKQVKSLAESIDEALNCHPSGPMSEE
PGSAQLEKRESKEQQEDSSATSFSDLPLYLDDPVPPPSPERLPSTEPPPQGRPEFWAPAP
LPPVPPPMPPGTREDGSREEGTRRGPGCLECRDFRLRAAHLPLLTIEPPSDSSVDLSDRS
DRGSVHRQLVYEADGCSPHGTLKHKGPPGRAPIPHRHYPAPEGPAPAPPGPLPPAPNSGT
GPSGVAGGRRLGKCEAAGENSDGGDNESLESSSNSNETINCSSGSSSRDSLREPPATGLC
KQTYQRETRHSWDSPAFNNDVVQRRHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAH
FILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEA
QKVERLIEAFSQRYCVCNPALVRQFRNPDTIFILAFAIILLNTDMYSPSVKAERKMKLDD
FIKNLRGVDNGEDIPRDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVGKKPVLSLPHR
RLVCCCQLYEVPDPNRPQRLGLHQREVFLFNDLLVVTKIFQKKKILVTYSFRQSFPLVEM
HMQLFQNSYYQFGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIAEVQEMEKYR
VESELEKQKGMMRPNASQPGGAKDSVNGTLARSSLEDTYGAGDGLKRGALSSSLRDLSDA
GKRGRRNSVGSLDSTIEVSVSSCPTHFCMSPALAIEPPTTFSICPQLCLSSLCLSLSLSS
TLPCPFSTPGPTPNRDALGFGPQETLTSRSCFFLRNGHAKEVLLIFPLPSEVQQNLGAEL
ATNTGLLFGFHCTLESLLLQLQGQTSPPPPFQGSVISSPRPHQRMPPPPPPPPPEEYKSQ
RPVSNSSSFLGSHPQFAPHGRHPLHQPTSPLPLYSPAPQHPPAHKQGPKHFIFSHHPQMM
PAAGAAGGPGSRPPGGSYSHPHHPQSPLSPHSPIPPHPSYPPLPPPSPHTPHSPLPPTSP
HGPLHASGPPGTANPPSANPKAKPSRISTVV
Download sequence
Identical sequences ENSRNOP00000030575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]