SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030648 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030648
Domain Number 1 Region: 198-234
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000101
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000144
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 3 Region: 142-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000144
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000030648
Domain Number - Region: 37-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000523
Family CCCH zinc finger 0.0055
Further Details:      
 
Domain Number - Region: 90-118
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0249
Family CCCH zinc finger 0.0058
Further Details:      
 
Domain Number - Region: 119-140
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0267
Family CCCH zinc finger 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030648   Gene: ENSRNOG00000025217   Transcript: ENSRNOT00000038958
Sequence length 243
Comment pep:novel chromosome:Rnor_5.0:12:14246609:14248395:1 gene:ENSRNOG00000025217 transcript:ENSRNOT00000038958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEIIASVDHIKFDLAIAVEQQLGAQPLPFPGMDKSGTAVCEFFLKAACGKGSMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRRTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPTKRAPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFL
SGQ
Download sequence
Identical sequences ENSRNOP00000030648 10116.ENSRNOP00000030648 ENSRNOP00000030648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]