SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000031097 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000031097
Domain Number 1 Region: 31-94
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000959
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000031097   Gene: ENSRNOG00000016525   Transcript: ENSRNOT00000032997
Sequence length 270
Comment pep:known chromosome:Rnor_5.0:17:17878841:17895037:1 gene:ENSRNOG00000016525 transcript:ENSRNOT00000032997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVSGTLRGRARPRGRAGNTTPPVPGNQTGTCAQLHPPPKGTLQVVRGDGTSLGTVLIF
HCPSGHQMVGSGLLTCAWNGSTADWSSGSPVCKAVPPHETFGFKVAVIASIVSCAIILLM
SMAFLTCCLLKCVQKSEQRRADRTAQLWYQLRGEDLETVQAAYLGLKGHNHNNSSSVGGG
SGGSSGGGGKPGIQHSQAHDNHSFTTDLSDIREQPVVTRSGDKDPWTFKMGAPSPGGSSN
SPRTYVMVHAMNSAGLAPGNPTRPKAYLPG
Download sequence
Identical sequences D3Z8I2
ENSRNOP00000022147 ENSRNOP00000031097 10116.ENSRNOP00000031097 NP_001100811.1.100692 NP_001100811.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]