SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000031570 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000031570
Domain Number 1 Region: 389-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-37
Family Calponin-homology domain, CH-domain 0.0000868
Further Details:      
 
Domain Number 2 Region: 87-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.24e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 
Domain Number 3 Region: 756-789
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000153
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000031570
Domain Number - Region: 790-818
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000856
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000031570   Gene: ENSRNOG00000027841   Transcript: ENSRNOT00000038551
Sequence length 1997
Comment pep:known chromosome:Rnor_5.0:4:220573991:220682835:-1 gene:ENSRNOG00000027841 transcript:ENSRNOT00000038551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKQETTNQAHVLFDRFVQATTCKGTLRAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYTDTELLLSRENVDQEALLNYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNININFLR
PSQVRHLYDSGESKDIHLEMENLVNSRTTPKLTRNESVARSSKLLGWCQRQTDGYSGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEQNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLSSSDTLDLNAEEKAVLIASTKSPISFLSKLGQT
ISRKRSPKDKKEKDSDGAGKRRKTSQSEEEEPPRSYKGERPTLVSTLTDRRMDAAIGNQN
KVKFMATQLLAKFEENAPAQSTGVRRQGSIKKEFPQNLGGSDTCYFCQKRVYVMERLSAE
GKFFHRSCFKCDYCATTLRLSAYAYDIEDGKFYCKPHYCYRLSGYAQRKRPAVAPLSGKE
AKGPLQDGPTADTNGLASAATSSAERSPGASMNGLEEPSIAKRLRGTPERIELENYRRSV
RQVEELEEVPEETQAEHNLSSVLDKGTEEDAASSSSESEMEEEEEEDEEDQLPTSDLGGV
PWKEAVRIHALLKGRSEEELEASKNFEPEEEEEEEEYEDDEEEYDEEEEESSEAGNKRLQ
QIITAADPLAIQADVHWTHIREREEEERMLPPSESSTSRAPLDEDDLEEDVDSEPAETEG
EAAEDGDPGDTGAELDDQHWSDDIPSDAETEHRLQSQTKVKADLELRVSENEEEKPSDTP
KQEERGPSQVSSPSQPPQKQAVLFSPAHSPGAEEAKPPPASITTKVKSPAEEPLFPAPLL
LREKPKAEGPEEQKTVHSPIRSQPVALPEARSPTSPTSSLQPESLLAPPTPPTPPSTQLP
ICSQPQPSSDASIPSPTKSPIRFQPVPAKTSTPLTPLPVKSQGDPKDRLSGPLAVEEALK
RSDLVEEFWMKSAEIRRSLGLTPVDRNKGSEPSLPSPALKPISLKSYSVDKSPQDEGLCL
LKPPSVPKRLGLPKSAGDQPPLLTPKSPSDKELRSNQEERRDLSSSSGLGLHGSSSNMKT
LGSQSFNTSDSTMLTPPSSPPPPPPPNEEPATLRRKPRQTFERREASVIPPPTPASFMRP
PREAAQPPREEVRKSFVESVDEIPFADDVEDTYDDKTEDSSLQEKFFTPPSCWSRSEKLP
AKENGRLPPLEQEVQPQKRALPLVSAEAKELAEERMRAREKSVKSQALRDAMAKQLSRMQ
AMEMVSSRSRPAPSPGKEPGLEATKHPSLRGSQEPTLKHEATSEEILSPPSDSGGPDGSV
TSSEGSSGKSKKRSSLFSPRRNKKEKKSKGEGGRPPEKPSLSLPEDVAAKPKSLWKSVFS
GYKKDKKKKSDEKSCSSTPSSGATVDSGQRRASPIVRAELHLRRQLSFSEDSDLSSDDIL
ERSSQKSKREPRTYTEEELSAKLTRRVQKAARRQAKQEELKRLHRAQIIQRQLEQVEEKQ
RQLEERGVAVEKALRGEAGMGKKDDPKLMQEWFKLVQEKNAMVRYESELMIFARELELED
RQSRLQQELRERMAVEDHLKTEEELSEEKKILNEMLEVVEQRDSLVALLEEQRLREKEED
KDLEAAMLCKGFSLDWS
Download sequence
Identical sequences D3ZGN7
ENSRNOP00000031570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]