SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000031588 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000031588
Domain Number 1 Region: 203-381
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.51e-33
Family APC10-like 0.0029
Further Details:      
 
Domain Number 2 Region: 1817-1877
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000459
Family ZZ domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1775-1826
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000695
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 90-147
Classification Level Classification E-value
Superfamily EF-hand 0.00000547
Family Calmodulin-like 0.053
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000031588
Domain Number - Region: 1112-1192
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000563
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Domain Number - Region: 2669-2758
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0589
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000031588   Gene: ENSRNOG00000024535   Transcript: ENSRNOT00000036278
Sequence length 2924
Comment pep:known_by_projection chromosome:Rnor_5.0:10:59099083:59235227:1 gene:ENSRNOG00000024535 transcript:ENSRNOT00000036278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAPSNSSEDEAAAAGGEGWSPHQDWAADSGATPGPGPAAAVLPSAAALLEPARLREAA
AALRPAPPCESLVSRHHGALLRWLEERLGRGEESVTLEQFRELLEARGAGCSGEQFEEAF
AQFDAEGDGTVDAENMLEALKNSSGANLQGELSHVIRQLQACSLVPGFIDIFSESKEGLG
THSSMILRFLHRNRVSSMVIPYPMLDHCNNMCTMRSSVLKDSLDQLLQKEKESPGDLARS
PEMDKLKSVTKCYAYIETSSNPADIYRMTNGETSSYWQSDGSARSHWIRLKMKPDVVLRH
LSIAVAATDQSYMPQQVTVAVGRSASDLQEVRDVHIPSNVTGYVTLLENANISQLYVQIN
IKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFVQT
VLHNTQKALQHMPPLSLSPGSTDFSTFLSPNVLEEVDSFLIRITSCCSTPEVELTLLAFA
LARGSIAKVMSSLCAISDHLDTQYDASSLISSMASVRQSLLLKYGKPLQLTLQACDVKGK
EDKSGPENLLVEPWTRDGFLTETGKTRASTIFSAGTESAFQVTQIRIMVRRGGIGAQCGL
VFAYNSPSDKFHAEEHFKRFEKYDRWKLQELRQFVKSRIGCSPDDLGEDDPIGWFELEEE
WDEADVKLQQCRVAKFLMVKFLCTRQESAERLGVQGLSISGYLRPARAEAEQSILYAHCR
RDTENIYGATLLLRTLQFIQQLAHDLVQQKESGLKYKSFLDFAGLDLQIFWNFYSKLKQN
PREECICAQTLLLQLLQSCFSVLQGDPQAVSEEEKPAAQRPEGIQAAKELYTHLCDVVDR
ADGESMPMEILKQEVRNTLLNGAAIFFPDRQTRRNQLFTMMKNVTEHERKQSLQLTFRSL
CTYFSDKDPGGLLLLPEKSDLATMNTSEVLAVMNTLLSVAARECELLMLGRAHGEVGSVL
FSLFWSVQGSLLSWCFLQLKSTDAAAKELAMDLIEKYVGQFLASMRVILESLLSQYSGKT
IVEKLCNSVFSMAARQLVIFLLDFCTLDVSHCTLLREFSTLTELLKKLCSDPEGGLSKLD
VETWQQEQPVVLHTWTKESTHNYENNCHEVSVFVSPGATYFEVEFDERCETEKRYDYLEF
TDSRGGKTRYDTKVGTYKWPKKVTFKDGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVAV
SWGLDLQLLVSRLMGRLASQCMALKSVHQLGSNLAISQAKLTAVLNSPLWKPVFRHQICP
ELELEASWPTHPHQDGKEVKNIPDDPCRHFLLDFAQSEPAQNFCGPYSELFKGFIQACRK
QAPKTDIVAGSTIDQAVNATFAALVYRTPDLYEKLQKYVHSGGKIALPEEFSQVYSLADG
IRIWMLEMKQKSLVSMGNDSEEKRGLETAEVNPENLAKECIQKSLLLLKFLPMSKSSKEN
CDKLVPVDETDRLQPLDRRQRTSSVVEEHFQGSASPTEAATPAADDKSPGLEMQPKLLPS
SGPSAAEVSTAEEPSSPSTPTRRPPFTRGRLRLLSFRSMEETRPVPTVKEKYPVLKDVMD
FIKDQSLSHESIVKVLSLRKAQAQSILEVLRIIQYCTESLGQPHCFHPPYILFLLELLTC
QKDFTNYFGHLEGCGADLHKEIRDTYYQLVLFLVKAIKGFSSINDRSLLPAVSCVQTALL
HLLDMGWEPSDLAFFVDIQLPDLLMNMSQENISIHDSVISQWSEEDELADAKQNSEWMDE
CQDGMFEAWYEKIAQEDPEKQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQCSD
MDLCKTCFLGGVKPEGHGDDHEMVNMEFTCDHCQGLIIGRRMNCNVCDDFDLCYGCYAAK
KYSYGHLPTHSITAHPMVTIRISDRQRFIQPYIHNYSWLLFAALALYSAHLTSTEHVDGE
QLDPQARGSAATLRSQCMQLVGDCLMKAHQGKGLKALALLGVLPDGDSTSENQALPVTVS
IQASEEQADAGLFVPCNGKRATDKEVGPLDCKQKKKAGEDLSIMKDPSCQIQVSDPPASD
HVPPGLPDAEHPDRSSQAPMEEKAITPSPEQVFAECSQKRILGLLAAMLPPIKSGPTVPL
IDLEHVLPLMFQVVISNAGHLNETYHLTLGLLGQLIIRLQPAEVDAAVMKVLSAKHNLRV
GLDWACSMAEILRSLNNAPLWRDVIATFTDHCIKQLPFQLKHTNIFTLLVLVGFPQVLCV
GTRCVYMDNANEPHNVIILKHFTEKNRAVIVDVKTRKRKTVKDYQLVQKGGGQECGTSQA
QLSQYSQHFAFIASHLLQTSMDSHCPEAVEATWVLSLALKGLYKTLKTHGFEETHATFLH
TDLLKLLVKKCSKGTGFSKTWLLRDLEILSIMLYSSKKEINTLTEHGDLELDERGDQEEE
LDRPVSSPGEAEQKKLDPLESLDEPTRICFLMAHDALNAPLHILRAIYELQMKKTDSFFL
EVQKRFDGDELTTDERIRSLAQRWQPSRSLRLEEQSAKAVDTDMIILPCLSRPARSDQAT
SESNPVTQKLISSTESELQQSYAKQRRSKSAALLHKELNCKSKRAVRDYLFRVNEATAVL
YARHVLASLLAEWPGHVPVSEDILELSGPAHMTYILDMFMQLEEKHQWEKILQKVLQGCR
ESMLGTMALAACQFMEEPGMEVQVRESKHPYNNNTSFEDKVHIPGAIYLSIKFDPQCNTE
EGCDELAMSSSSDFQQDRHNFSGSQQKWKDFELPGDTLYYRFTSDMSNTEWGYRFTVTAG
HLGRFQTGFEILKQMLSEERVVPHLPLGKIWEWLVGVACRQTGHQRLKAIHLLLRIVRCC
SHSDLCDLGLLKPLWQLFTHMEYGLFEDVTQPGILLPLHRALTELFFVTENRAQELGLLQ
EYLLALTTEDHLLRCAAQALQNIAAISLAINYPNKATRLWNVEC
Download sequence
Identical sequences 10116.ENSRNOP00000031588 ENSRNOP00000031588 ENSRNOP00000031588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]