SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000031964 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000031964
Domain Number 1 Region: 156-218
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.21e-16
Family Complement control module/SCR domain 0.00032
Further Details:      
 
Domain Number 2 Region: 94-166
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.06e-16
Family Complement control module/SCR domain 0.00031
Further Details:      
 
Domain Number 3 Region: 217-282
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 451-509
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000135
Family Complement control module/SCR domain 0.00088
Further Details:      
 
Domain Number 5 Region: 34-99
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000328
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 299-353
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000133
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 7 Region: 369-412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000537
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000031964   Gene: ENSRNOG00000025862   Transcript: ENSRNOT00000035577
Sequence length 577
Comment pep:known chromosome:Rnor_5.0:13:52375712:52420503:-1 gene:ENSRNOG00000025862 transcript:ENSRNOT00000035577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAWSLHELWKTSHSTLFQVTLATVLMAPVLGDCGPPPSLPFASPISQLDEVSFPPGAVL
KYTCHHGFKRTNSSHITCDENGSWVYTTFCARKRCKNPGELVNGKIEILSDLLVGSNIEF
SCSEGYLLIGSATSRCEVQGKGVNWSDSLPECVIATCEPPPVINNGKHSGREEDLYTYGS
MVIYSCDPSYTLFGNASIVCTVVNKTVGVWSPHPPACEKIVCHQPQIPKGELVPGFRHFH
TYKDALEIRCKKGFALRGNSVIHCEANGEWFPSVPTCEPNGCIDIPDISYASWDGNRFPL
ENTAVFEIGTKLKYRCKPGYRANVHDVQIVTCQENLTWSSPSGCERVCCPTPNMEKIKIV
SERRDFTGTCVYAYGDYVFYICSEGTYPMTTDGRSSCQADGKWDPAIPSCEADPSLQNHF
ALTFPNISETNVTNRTYLLENENATESFIKAVCPKPEIINGNLSVEKEIYAEMENITIQC
DSGYDLVGSSNIICLENRTWYPDIPFCIMEGPEDCEIVNKGRQLLQCLSSPEDVQRALEV
YKLSLEIERLEQQREKRTSVHRKAHYTKVDGPFRPFS
Download sequence
Identical sequences G3V902
10116.ENSRNOP00000031964 ENSRNOP00000048027 NP_877967.2.100692 NP_877967.2.4139 ENSRNOP00000031964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]