SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000032023 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000032023
Domain Number 1 Region: 454-762
Classification Level Classification E-value
Superfamily Folate-binding domain 1.02e-79
Family Aminomethyltransferase folate-binding domain 0.0000899
Further Details:      
 
Domain Number 2 Region: 42-257,362-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.15e-53
Family FAD-linked reductases, N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 259-361
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.73e-18
Family L-aminoacid/polyamine oxidase 0.043
Further Details:      
 
Domain Number 4 Region: 764-857
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000000000000654
Family Aminomethyltransferase beta-barrel domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000032023   Gene: ENSRNOG00000022593   Transcript: ENSRNOT00000038452
Sequence length 878
Comment pep:known chromosome:Rnor_5.0:19:53934957:53967868:-1 gene:ENSRNOG00000022593 transcript:ENSRNOT00000038452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYRLLSIVQRQRTSPGWQTWSSARSSTSAAEAQSIALPAQAQVVICGGGIMGTSVAYHL
SKMGWQDIVLLEQGRLAAGSTRFCAGILSTARHSSIEQKMADYSNKLYHQLEQETGIQTG
YLRTGSISLAQTQDRLISLKRINSRLNVVGIPSEIISPKKVAELHPLLNVHDLVGAMHVP
EDAVVSSADVALALASAASQNGVQIYDRTSVLHVLTKKGRVTGVDTDKGQIECQYFVNCA
GQWAYELGLSSEEPVSIPLHACEHFYLLTRPCDAPLQSSTPTVVDADGRIYIRNWQGGVL
SGGFEKNPKPIFTEGKNQLEIQNLREDWDHFEPLLSSLLRRMPGLESVEILKLVNCPETF
TADMKCIMGESPVVQGYFVLAGMNSAGLSLGGGAGKLLAEWMVYGYPSENVWELDLQRFG
ALQGSRTFLRHRVMEVMPLIYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFER
PKYFVPPNKDLLALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQA
LESLQYLFSNDLDVPVGHIVHTGMLNEYGGHENDCSIARLTKRSFFMISPTDQQVHCWAW
LHKYLPKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPTLFCKEMSVGYA
NGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAF
WGQDLNTLTTPLECGGESRVKLEKGIDFIGRDALLQQKQTGVYKRLVMFILDDHDTDLDL
WPWWGEPIYRNGKYAGKTTSSAYSYTLERHVCLGYVHNFSEDSGEEQVVTADFINRGEYE
IDIAGHRFQAKAKLYPVTSFFTHKRRKDDVELSDFHGK
Download sequence
Identical sequences D3ZXA6
NP_001100900.1.100692 NP_001100900.1.4139 XP_006255658.2.100692 XP_008770736.1.100692 ENSRNOP00000032023 10116.ENSRNOP00000032023 ENSRNOP00000032023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]