SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000032282 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000032282
Domain Number 1 Region: 677-1087
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.36e-128
Family PDEase 0.0000000000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000032282   Gene: ENSRNOG00000025042   Transcript: ENSRNOT00000032843
Sequence length 1141
Comment pep:known chromosome:Rnor_5.0:4:239659270:239921900:1 gene:ENSRNOG00000025042 transcript:ENSRNOT00000032843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRGEAAQDWAKPGLRGPSPAPVARGDHRCRGGSPSSPRGSGCCWRALALQPLRRSPQL
SSALCAGSLSVLLALLVRLVGGEVGGELESSQEAAAEEEEEEGARGGVFPGPRGGAPGGG
AQLSPWLQPAALLFSLLCAFFWMGLCLLRAGVRLPLAVALLAACCAGEALVQLSLGVGDG
RLLSLPAAGVLLSCLGGATWLVLRLRLGVLMVALTSALRTVALVSLERFKVAWRPYLAYL
AAVLGLLLARYAEQLLPQCSGPAPPRERFGSQSSARTKEEIPGWKRRRRSSSVVAGEMSG
CGGKSHRRTSLPCIPREQLMGHSEWDHKRGSRGSQSGTSVTVDIAVMGEAHGLITDLLAD
PSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPTVTFSENYTCSDSEEGLEKDKLAIPK
RLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSASIKPHEAPSPSAVNPDSWN
APVLMTLTKSRSFTSSYAVSAANHVKAKKQNRPGGLDKISPVPSPSSSPPQGSPTSSPVS
GIASVQFPESPEVTTKRGPGSHRALTYTQSAPDLSPQIPPSPVICSSCGRPYSQGNPADG
PSERSGPAMQKPNRTDDTSQVTSDYETNNNSDSSDILQNDEEAECQREPLRKASACGTYT
PQTMIFLDKPILAPEPLVMDNLDSIMDQLNTWNFPIFDLVENIGRKCGRILSQVSYRLFE
DMGLFEAFKIPVREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLPSVIG
DHGSASDSDSDSGFTHGHMGYVFSKAYHVPDDKYGCLSGNIPALELMALYVAAAMHDYDH
PGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLVNLDHVEFKHFRFL
VIEAILATDLKKHFDFVAKFNAKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKDL
HLRWTEGIASEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCHSYDSAG
LMPGKWVDDSDDSGDTDDPEEEEEEAETPHEEETCENSEAPRKKSFKRRRIYCQITQHLL
QNHMMWKKVIEEEQCLSGTENQAPDQAPLQHSSEQIQAIKEEEEEKGKPRAEETLAPQPD
L
Download sequence
Identical sequences Q62865
ENSRNOP00000032282 10116.ENSRNOP00000032282 NP_059033.1.100692 NP_059033.1.4139 ENSRNOP00000032282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]