SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000032890 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000032890
Domain Number 1 Region: 407-632
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.51e-78
Family CAT-like 0.000027
Further Details:      
 
Domain Number 2 Region: 207-300
Classification Level Classification E-value
Superfamily Single hybrid motif 1.26e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.00000283
Further Details:      
 
Domain Number 3 Region: 82-176
Classification Level Classification E-value
Superfamily Single hybrid motif 9.95e-23
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000208
Further Details:      
 
Domain Number 4 Region: 335-379
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.000000000000863
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000032890   Gene: ENSRNOG00000009994   Transcript: ENSRNOT00000032152
Sequence length 632
Comment pep:known chromosome:Rnor_5.0:8:53659922:53685238:-1 gene:ENSRNOG00000009994 transcript:ENSRNOT00000032152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRVCARRVQSAVPRAGFRARWATLKGPRTGPAAVRCGSGIPSYGVRSLCGWSYGSATVP
RNRILQQLLGSPSRRSYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKISEGDLIAEVE
TDKATVGFESLEECYMAKILVPEGTRDVPVGSIICITVEKPQDIEAFKNYTLDSATAATQ
AAPAPAAAPAAAPAAPSASAPGSSYPVHMQIVLPALSPTMTMGTVQRWEKKVGEKLSEGD
LLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKQEDIAAFADYRPTE
VTSLKPQAPPPVPPPVAAVPPIPQPLAPTPSAAPAGPKGRVFVSPLAKKLAAEKGIDLTQ
VKGTGPEGRIIKKDIDSFVPTKAAPAAAAAAPPGPRVAPTPAGVFIDIPISNIRRVIAQR
LMQSKQTIPHYYLSVDVNMGEVLLVRKELNKMLEGKGKISVNDFIIKASALACLKVPEAN
SSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQP
HEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVT
LSCDHRVVDGAVGAQWLAEFKKYLEKPVTMLL
Download sequence
Identical sequences P08461
10116.ENSRNOP00000032890 ENSRNOP00000032890 NP_112287.1.100692 NP_112287.1.4139 ENSRNOP00000032890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]