SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000033594 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000033594
Domain Number 1 Region: 7-208
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-49
Family Pleckstrin-homology domain (PH domain) 0.00000401
Further Details:      
 
Domain Number 2 Region: 292-346
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000774
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000033594   Gene: ENSRNOG00000023881   Transcript: ENSRNOT00000030159
Sequence length 354
Comment pep:known chromosome:Rnor_5.0:10:84110240:84412121:1 gene:ENSRNOG00000023881 transcript:ENSRNOT00000030159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAIALPEEICWLLEDAEDFLAEGLQNENLSPGAQDQRDHILRGFQQIKSRYCWDFQPQG
DDLGQDGSDENLSGTHGPALASDASFWSDYQEEGIDDIIRGAQELDNVIKQGYLEKKSKD
HSFFGSEWQKRWCVISRGLFLYYANEKSKQPKGTFLIKGYNVRMAPHLRKDSKKDSCFEL
TSQDRRSYEFTAFSPAEARDWVDQISFLLKDLSSLTIPFEEEEEEEEEDKEQEEMYNDID
GFDSARSGSQGRAMALPEPLDKEEDVYEVLPDEDDLEEDACGAHRRRVDYADYYQGLWDC
HGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSIIGIVPKDYLTTAFEMEGR
Download sequence
Identical sequences Q4V7G1
10116.ENSRNOP00000033594 ENSRNOP00000033594 NP_775433.2.100692 NP_775433.2.4139 ENSRNOP00000033594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]