SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000033692 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000033692
Domain Number 1 Region: 12-311
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.21e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000033692   Gene: ENSRNOG00000024823   Transcript: ENSRNOT00000035982
Sequence length 373
Comment pep:known chromosome:Rnor_5.0:20:33137031:33152531:1 gene:ENSRNOG00000024823 transcript:ENSRNOT00000035982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQVSVDTGAVHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVESG
FAKKTFISYSVTFKDNFRQGKVIGIDLKNRMVLLEGGEALPFSHLILATGSTGPFPGKFN
EVSCQQAAIQAYEDMVKQIQRSQFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSRVPLA
DKELLPCVRQEVKEILLRKGVQLLLSERVSNLEELPRNEYREYIKVETDKGTEVATNMVI
VCNGIKINSSAYRSAFESRLASNGALKVNEFLQVEGYSNIYAIGDCADIKEPKMAYHAGL
HANIAVANIVNSMKQRPLKAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLAKSRDLL
ISTSWKTMRQSPP
Download sequence
Identical sequences D4AA14
10116.ENSRNOP00000033692 ENSRNOP00000033692 NP_001132955.1.100692 NP_001132955.1.4139 ENSRNOP00000033692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]