SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034339 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034339
Domain Number 1 Region: 10-180
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.21e-43
Family HD domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034339   Gene: ENSRNOG00000021442   Transcript: ENSRNOT00000029444
Sequence length 199
Comment pep:known chromosome:Rnor_5.0:1:30034693:30054904:-1 gene:ENSRNOG00000021442 transcript:ENSRNOT00000029444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASATSNCQAGLLRFLRLVGQLKRVPRTGWVYRNVEKPESVSDHMYRMAVMAMVTRDDRL
NKDRCIRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKEITQLLPEDLRKELYELW
EEYETQSSEEARFVKQLDQCEMILQASEYEDMENKPGRLQDFYDSTAGKFSHPEIVQLVS
ELETERNASMATTPSEPGS
Download sequence
Identical sequences D3ZKT8
NP_001101930.1.100692 NP_001101930.1.4139 XP_008756894.1.100692 10116.ENSRNOP00000034339 ENSRNOP00000034339 ENSRNOP00000034339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]