SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034649 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034649
Domain Number 1 Region: 232-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.31e-31
Family Leech intramolecular trans-sialidase, N-terminal domain 0.091
Further Details:      
 
Domain Number 2 Region: 626-768,798-817
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000209
Family Zinc protease 0.079
Further Details:      
 
Domain Number 3 Region: 1521-1595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000278
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1587-1644
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000681
Family Complement control module/SCR domain 0.0057
Further Details:      
 
Domain Number 5 Region: 1046-1107
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000771
Family Fibronectin type III 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000034649
Domain Number - Region: 1477-1527
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000122
Family Complement control module/SCR domain 0.0073
Further Details:      
 
Domain Number - Region: 524-639,726-745
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00178
Family Matrix metalloproteases, catalytic domain 0.07
Further Details:      
 
Domain Number - Region: 1413-1464
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00417
Family Complement control module/SCR domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034649   Gene: ENSRNOG00000042860   Transcript: ENSRNOT00000039210
Sequence length 1788
Comment pep:known chromosome:Rnor_5.0:13:81307018:81574056:-1 gene:ENSRNOG00000042860 transcript:ENSRNOT00000039210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCWKVLRISLVVLAGWAFSTTNSELGWTRKKYLAQRAHLNQALLEGERCWLAYKVRRPR
CAPQHHPFGVYPSHHENYLRSYPVGMQQTQYAEWSQRSTERQAPSGVPRDLTENPAGVKR
KSEQPAAPWVGDGPIGQSQLLRDDDTYLGKGGSKEALGEPAIRGSSETAVSTITTFTYQK
GPTAETQRKGQSKSRLPRQVQKRQAEDMTRDPQNTPQDVQLWPKDPLKHGDSNSPLEGTI
QNGGGASAQRAETFNPQGGLPVLYFSGKRERLLLRPEVLAEIPREAFTVEAWVRPEGGQS
NPAIIAGVFDNCSHTVNDKGWALGIRSGKDKGQRDARFFFSLRTDRMKKATTVIGHSRYQ
PGTWTHVAATYDGQHMALYVDGTRVAASPDQSGPLNSPFMASCRSLLLGGDNSENGHYFR
GYLGTLVIWSTALSQLHLQHSPQHPSGVDELTTLILTATFDPLKEQWAPFRDETYPLMEV
FQDSESQPEILSPLQPPPCGQTACDNVELISQYNTHGPLRREKVVRYQVVNICDDEGLHP
IVSDLQIRRQHEALNQAFSRYNISWQLSVHRVHNSTLRHRVVLVNCEPSKIGNDHCDPEC
EHPLTGFDGGDCRLQGRCYSWNRRDGLCHMECNNMLNDFDDGDCCDPEVTDVRKTCFDPD
SPKRAYMSVKELKEALQLNSTHFLNVYFASSVREDLAGSATWPWDKDALSHLGGVVLNPA
YYGMLGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMETGDLCADTAPTPKS
KLCRDPEPANDTCGFTLFPRAPFNNYMSYTDDDCTDNFTPNQVARMHCYLDLVYQQWSES
QKPTPIPIPPMVIGQTHKSLTIHWLPPISGVVYDRTPDSMCGACTEDGTFRQYVYKASSG
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLNHMNMTVPCPAEGCSLELLFQHP
VQADTLTLWVTYLSVNSSKAFFDIEILLEHKESMHLGPLNTFCDMPLTIKLHVDEKVVGA
KVYTFDERMEIDAALLTSRPSSSLCSGCRPVSYQVLREPPFSSGLPMVVTHPHRKFTDTE
VIPGQVYQYQVQAEAGGELGEASPPLSHIHGGPYCGDGKVERSMGEMCDDGDLLNGDGCS
RACELEEGFNCAGEPSLCYRYEGDGICEAFEKKTSIIDCGLHTPEGYLDQWASQAYSYHE
DKKKCPVSLVTGEPHSLICTSRHPDSSPYHLFPGWFPCVFNLKKDQDAGREKSKDSLQKE
NEIWLEVCFNKPGVAVAIFIFLASDGLNPGEHQQATVTPYLIDVSGNNHSLGTYGLSCQH
NPLVINVSHHANVNPQHTSTMLLNFSSPLVGISAVALRTSSQTISSSLSNCIPEQNHQGQ
SCAQRPCGEQGRCVPLLLDHTDMVNCTSSGPGHMECAITCQRGYVLQTSSGQYLRNMQKE
ILLTCSSGHWNNNVNCKRLDCGVPDSSLVNYANFSCTEGTDFLKRCSISCVPPAKLQGLN
PWLTCLEDGLWSLPEVYCKLECEAPPVIPNAHLLRPHCLEGNHDVSTICKYECKPGYYVK
ESSGSQGKNKFLKIQCLDDGTWEQGSCVPVVCEPPPPVFEGMYDCTNGFKLDSQCVLNCN
QETERIPILCTKEGLWTQEFKLCENLQGECPPPTSELNSVEYKCGQGYGIGAVCSPSCVI
PPSDPVILPENVTTDTLEHWMEPVKVQSIVCTGRRQWHPDPSLVHCIQSCEPFQADGWCD
TINNRAYCNYDGGDCCSSTLSSKKVIPFAADCDSDECTCRDPKAEENQ
Download sequence
Identical sequences D3ZQ32
XP_002728071.2.100692 XP_017460131.1.4139 ENSRNOP00000034649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]