SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000035476 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000035476
Domain Number 1 Region: 96-240
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-40
Family C-type lectin domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000035476   Gene: ENSRNOG00000042139   Transcript: ENSRNOT00000029072
Sequence length 243
Comment pep:known chromosome:Rnor_5.0:4:222969397:222981511:-1 gene:ENSRNOG00000042139 transcript:ENSRNOT00000029072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPNIYTDVNFKNQPVSSGTVSDSSSCTISSSALPKKTTVHKSNPGFPTLLLALLIFFL
VLAILSSVGLTTLFHMYSDLLEEKNTLQQLNHAKLHCIKNHSSVEDKVWSCCPKNWKPFG
SHCYFTSRDSASWSDSEEKCSHRGAHLLVIHSQEEQDFITDTLNPRAHYYVGLSDTEGHG
KWQWVDQTPFNQNATSWHADEPSGNKGFCVVLSYHPNLKGWGWSVAPCDGYHRLVCKMRQ
LYV
Download sequence
Identical sequences Q5YIR9
NP_001005890.1.100692 NP_001005890.1.4139 ENSRNOP00000035476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]