SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000036311 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000036311
Domain Number - Region: 21-87
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0994
Family Troponin T 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000036311   Gene: ENSRNOG00000025590   Transcript: ENSRNOT00000035656
Sequence length 152
Comment pep:novel chromosome:Rnor_5.0:18:40627705:40634001:1 gene:ENSRNOG00000025590 transcript:ENSRNOT00000035656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEPSHKNNSTQEERTNHVFPEKSSQIGQKQLQQIERQLKCLAFQNPGPQVADFNPETRQ
QKKKARMSKMNEYFSVKYKVMKKYDKNGRLICNDVDLCDCLEKNCLGCFYPCPKCNSNKC
GPECRCNRRWVYDAIVTESGEVISTLPFSVPD
Download sequence
Identical sequences D3ZBL0
10116.ENSRNOP00000036311 ENSRNOP00000036311 XP_006222631.1.4139 XP_006222632.1.4139 XP_006222633.1.4139 XP_006254762.1.100692 XP_006254763.1.100692 XP_006254764.1.100692 XP_008770405.1.100692 XP_008770406.1.100692 XP_008772347.1.4139 XP_008772348.1.4139 ENSRNOP00000036311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]