SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000036478 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000036478
Domain Number 1 Region: 415-606
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.28e-38
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 2 Region: 610-790
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-37
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 6-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-32
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 4 Region: 304-403
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000118
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 5 Region: 816-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000035
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000036478   Gene: ENSRNOG00000027796   Transcript: ENSRNOT00000035388
Sequence length 852
Comment pep:novel chromosome:Rnor_5.0:6:24408199:24715174:-1 gene:ENSRNOG00000027796 transcript:ENSRNOT00000035388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKN
GAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTIS
VDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVYRCHGTRLN
SWAHLCRSGLRAHLLKIGCSQSEWLYTLTLCTPWSHYLLKLKWKTKSTWKISIDYKENTW
MPFGSVLFMHGSSSHQAEWKHPQIINLDLYTLQKLIDGADYGLSGMGKSGGRKARAREEQ
ESKGSWKGHEYYRLGRICTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPT
EVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSRETAKPCLSNPCKNNG
MCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQ
RAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEW
HTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPSNFIGHL
QSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATLQAYTSMHL
FFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWH
NVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGF
QGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDC
SMTSFSGPLCND
Download sequence
Identical sequences ENSRNOP00000036478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]