SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000037216 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000037216
Domain Number 1 Region: 304-366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.7e-19
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number 2 Region: 245-301
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000104
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 3 Region: 4-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000144
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 129-188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000144
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 184-241
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000288
Family Complement control module/SCR domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000037216
Domain Number - Region: 61-121
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000498
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000037216   Gene: ENSRNOG00000021575   Transcript: ENSRNOT00000029294
Sequence length 367
Comment pep:novel chromosome:Rnor_5.0:13:61660054:61676318:-1 gene:ENSRNOG00000021575 transcript:ENSRNOT00000029294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACKPPDIPNGIYSPQRVTYTAQDEIKFECKDGFYSATQETVAKCTSTGWIPAPKCRQVK
PCEFPQIKNGGLYHERRRRPYFPVPIGNEYSYYCDNGFLTPSLSYWDYLRCTEKGWEPEV
PCLKQCVFHYVENGESSYWQRKYVEEQAVKVQCYNGYSLPNGQDTITCTENGWSPPAKCI
TLESCDVPIFENAGTNNDSTWFKLNDKINYECHVGYVNKHKHTKGSITCHHDGWSDIPSC
YDSTKICGPPPPIANGDTTSFPLPVYIPPSSVEYQCQSLYQLQGNKTIICINGEWSDPPK
CLHPCIISIEIMRKHNITFRTEENQRLYYQSGEMQEFKCKNGHHLATTQPLITICINGHL
NYPVCTK
Download sequence
Identical sequences ENSRNOP00000037216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]