SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000037568 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000037568
Domain Number 1 Region: 36-279
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.13e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000447
Further Details:      
 
Domain Number 2 Region: 280-485
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 3.14e-42
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00026
Further Details:      
 
Domain Number 3 Region: 624-786
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.81e-34
Family AlaX-like 0.057
Further Details:      
 
Domain Number 4 Region: 544-620
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000003
Family AlaX-M N-terminal domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000037568   Gene: ENSRNOG00000025808   Transcript: ENSRNOT00000031549
Sequence length 985
Comment pep:known chromosome:Rnor_5.0:9:16570774:16769589:-1 gene:ENSRNOG00000025808 transcript:ENSRNOT00000031549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVAAAAGRLRRAIGRSCPWQRFSTEPHPPHGAAVRDAFLSFFRDRHGHRLVPSASVR
PRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGRHNDLEDVGRDL
SHHTFFEMLGNWAFGGEYFKKEACSMAWELLTQVYGIPEDRLWVSYFSGDSKTGLDPDLE
TRDIWLSLGVPASRVLSFGLQENFWEMGDTGPCGPCTEIHYDLAGGMGPPQLVELWNLVF
MQHYREADGSLHLLPQQHVDTGMGLERLVAVLQGKHSTYDTDLFSPLLDAIHQSCRVPPY
SGRVGAADEGRIDTAYRVVADHIRTLSVCIADGVSPGMSGAPLVLRRILRRAVRYSTEVL
QAPPGFLGNLVPVVVATLGAAYPELQKNSVKVLIWEIANLVSEDEAAFLASLQRGRRIID
RTVKRLGPSDLFPAEVAWSLSLSGNLGIPLDLVQLMLEEKGVKLDTAGLEQLAQKEAQHR
AQQAEAAQEEGLCLDVHALEELHRQGIPTTDDSPKYNYSLRPNGDYEFGLCEAQVLQLYS
ETGTAVASVGEGQRCGLLLDRTNFYAEQGGQASDRGYLIRTGQQDVLFPVARAQVCGGFI
LHEAMAPECLQVGDRVQLYVDKAWRMGCMVKHTATHLLNWALRQTLGPTTEQRGSHLNPE
RLRFDVATQTPLTTEQLRTVESYVQEAVGQDKPVYMEEVPLAHTARIPGLRSLDEVYPDP
VRVVSVGVPVAQALAPASQAALQTSVELCCGTHLLSTGAVGDLVIIGDRQLVKGITRLLA
ITGEQAQQAREVGQSLSQEVEVASERLSRGSRDLLEAHRLSKDIGRLIEFTESAVIPQWQ
RQEQQTTLKMLQRRANTAIRKLEKSQATEKSQELLKRHSEGPLIVDTVSAQSLSVLVKVV
RQLCKQAPSMSVLLLSPQPTGSVLCACQVAQGATPTFTAEAWALAVCSHMGGKAWGSPVI
AQGTGHTADLEAALRTARAYALNQL
Download sequence
Identical sequences D3ZX08
ENSRNOP00000037568 10116.ENSRNOP00000037568 ENSRNOP00000037568 NP_001100361.1.100692 NP_001100361.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]